CCAR1 Polyclonal Antibody - E-AB-14953 Size:120μL and a mutation in this

and a mutation in this gene has been associated with insulin resistance

DPT is expressed in various tissues

an autosomal recessive disorder due to defective import mechanisms for peroxisomal matrix enzymes

RDt VCGCRKNQYRHYWSENLFQCFNCSLCLNGt VHLSCQEKQNt VCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIE

They are expressed on the surface of certain cells

CCAR1 Polyclonal Antibody - E-AB-14953 Size:120μL and a mutation in thisCCAR1 Polyclonal Antibody Sizes: 60L, 120L, 200L Catalogue Numbers: E AB 14953 60, E AB 14953 120, E AB 14953 200 Citations, Manuals and MSDS Available upon request. Abbreviation: CCAR1 Target Synonym: CARP 1; Carp1; Ccar1; CCAR1; Cell cycle and apoptosis regulatory protein 1; cell division cycle and apoptosis regulator 1; Cell division cycle and apoptosis regulator protein 1; Death inducer with SAP domain; FLJ10590; FLJ10839; FLJ13376; FLJ20734;